C2orf60 Blocking Peptide (33R-6737)
A synthetic peptide for use as a blocking control in assays to test for specificity of C2orf60 antibody, catalog no. 70R-9071
Overview
Overview
| Synonyms | C2orf60 control peptide, C2orf60 antibody Blocking Peptide, Anti-C2orf60 Blocking PeptideFLJ37953 Blocking Peptide, MGC70509 Blocking Peptide, C2orf60, Corf60-2, Corf60 2, Corf60-2 Blocking Peptide, Corf60 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | NKDPTAASRAAQILDRALKTLAELPEEYRDFYARRMVLHIQDKAYSKNSE |
|---|---|
| Molecular Weight | 36 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | C2orf60 is Involved in cell differentiation and/or proliferation. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product