C2orf60 Blocking Peptide (33R-6737)

A synthetic peptide for use as a blocking control in assays to test for specificity of C2orf60 antibody, catalog no. 70R-9071

Synonyms C2orf60 control peptide, C2orf60 antibody Blocking Peptide, Anti-C2orf60 Blocking PeptideFLJ37953 Blocking Peptide, MGC70509 Blocking Peptide, C2orf60, Corf60-2, Corf60 2, Corf60-2 Blocking Peptide, Corf60 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues NKDPTAASRAAQILDRALKTLAELPEEYRDFYARRMVLHIQDKAYSKNSE
Molecular Weight 36 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C2orf60 is Involved in cell differentiation and/or proliferation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors