C3ORF10 antibody (70R-1299)

Rabbit polyclonal C3ORF10 antibody raised against the middle region of C3Orf10

Synonyms Polyclonal C3ORF10 antibody, Anti-C3ORF10 antibody, hHBrk1 antibody, Chromosome ORF-3, Chromosome ORF 3 antibody, MDS027 antibody, Chromosome ORF-3 antibody, HSPC300 antibody, Chromosome 3 ORF, Chromosome ORF 3
Specificity C3ORF10 antibody was raised against the middle region of C3Orf10
Cross Reactivity Human,Mouse,Rat,Dog,ZebraFish
Applications IHC, WB
Immunogen C3ORF10 antibody was raised using the middle region of C3Orf10 corresponding to a region with amino acids YIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK
Assay Information C3ORF10 Blocking Peptide, catalog no. 33R-10134, is also available for use as a blocking control in assays to test for specificity of this C3ORF10 antibody


Immunohistochemical staining using C3ORF10 antibody (70R-1299)

C3ORF10 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 9 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of C3ORF10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C3orf10 is involved in regulation of actin and microtubule organization. It is a part of a WAVE complex that activates the Arp2/3 complex.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using C3ORF10 antibody (70R-1299) | C3ORF10 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using C3ORF10 antibody (70R-1299) | C3ORF10 antibody (70R-1299) used at 2.5 ug/ml to detect target protein.
  • Immunohistochemical staining using C3ORF10 antibody (70R-1299) | C3ORF10 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain  Hepatocytes (arrows)  in Human Liver. Magnification is at 400X

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors