C3ORF17 antibody (70R-6829)

Rabbit polyclonal C3ORF17 antibody raised against the middle region of C3Orf17

Synonyms Polyclonal C3ORF17 antibody, Anti-C3ORF17 antibody, Chromosome ORF-3 antibody, DKFZP434F2021 antibody, Chromosome ORF 3 antibody, Chromosome ORF-3, Chromosome ORF 3, Chromosome 3 ORF
Specificity C3ORF17 antibody was raised against the middle region of C3Orf17
Cross Reactivity Human
Applications WB
Immunogen C3ORF17 antibody was raised using the middle region of C3Orf17 corresponding to a region with amino acids KLQSTLLREIQQFSQGTRKSATDTSAKWRLSHCTVHRTDLYPNSKQLLNS
Assay Information C3ORF17 Blocking Peptide, catalog no. 33R-4532, is also available for use as a blocking control in assays to test for specificity of this C3ORF17 antibody


Western Blot analysis using C3ORF17 antibody (70R-6829)

C3ORF17 antibody (70R-6829) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C3ORF17 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of the C3orf17 protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C3ORF17 antibody (70R-6829) | C3ORF17 antibody (70R-6829) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors