C3orf59 Blocking Peptide (33R-7720)

A synthetic peptide for use as a blocking control in assays to test for specificity of C3orf59 antibody, catalog no. 70R-9227

Synonyms C3orf59 control peptide, C3orf59 antibody Blocking Peptide, Anti-C3orf59 Blocking Peptide, chromosome 3 open reading frame 59 Blocking Peptide, C3orf59, Corf59-3, Corf59 3, Corf59-3 Blocking Peptide, Corf59 3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QSDGGDPNQPDDRLAKKLQQLVTENPGKSISVFINPDDVTRPHFRIDDKF
Molecular Weight 55 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of C3orf59 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors