C3ORF62 antibody (70R-4276)

Rabbit polyclonal C3ORF62 antibody raised against the middle region of C3Orf62

Synonyms Polyclonal C3ORF62 antibody, Anti-C3ORF62 antibody, FLJ43654 antibody, Chromosome ORF 3, MGC61663 antibody, Chromosome ORF 3 antibody, Chromosome ORF-3 antibody, MGC62079 antibody, Chromosome ORF-3, MGC23381 antibody, Chromosome 3 ORF
Specificity C3ORF62 antibody was raised against the middle region of C3Orf62
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen C3ORF62 antibody was raised using the middle region of C3Orf62 corresponding to a region with amino acids IDHTSIRTIEELAGKIEFENELNHMCGHCQDSPFKEEAWALLMDKSPQKA
Assay Information C3ORF62 Blocking Peptide, catalog no. 33R-3915, is also available for use as a blocking control in assays to test for specificity of this C3ORF62 antibody


Western Blot analysis using C3ORF62 antibody (70R-4276)

C3ORF62 antibody (70R-4276) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C3ORF62 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 3 ORF protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C3ORF62 antibody (70R-4276) | C3ORF62 antibody (70R-4276) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors