C4BPA Blocking Peptide (33R-7781)

A synthetic peptide for use as a blocking control in assays to test for specificity of C4BPA antibody, catalog no. 70R-5739

Synonyms C4BPA control peptide, C4BPA antibody Blocking Peptide, Anti-C4BPA Blocking Peptide, Complement 4 Binding Protein Alpha Blocking Peptide, C4BP Blocking Peptide, PRP Blocking Peptide, C4BP, CBP-4, CBP 4, CBP-4 Blocking Peptide, CBP 4 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL
Molecular Weight 62 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C4BPA is a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. Along with a single, unique beta-chain, seven identical alpha-chains encoded by this gene assemble into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors