C4BPA Blocking Peptide (33R-7781)
A synthetic peptide for use as a blocking control in assays to test for specificity of C4BPA antibody, catalog no. 70R-5739
Overview
Overview
| Synonyms | C4BPA control peptide, C4BPA antibody Blocking Peptide, Anti-C4BPA Blocking Peptide, Complement 4 Binding Protein Alpha Blocking Peptide, C4BP Blocking Peptide, PRP Blocking Peptide, C4BP, CBP-4, CBP 4, CBP-4 Blocking Peptide, CBP 4 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL |
|---|---|
| Molecular Weight | 62 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | C4BPA is a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. Along with a single, unique beta-chain, seven identical alpha-chains encoded by this gene assemble into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product