C4ORF20 antibody (70R-3548)

Rabbit polyclonal C4ORF20 antibody raised against the middle region of C4Orf20

Synonyms Polyclonal C4ORF20 antibody, Anti-C4ORF20 antibody, Chromosome ORF 4 antibody, Chromosome ORF-4, Chromosome ORF-4 antibody, FLJ11200 antibody, UFSP2 antibody, Chromosome 4 ORF, Chromosome ORF 4
Specificity C4ORF20 antibody was raised against the middle region of C4Orf20
Cross Reactivity Human
Applications WB
Immunogen C4ORF20 antibody was raised using the middle region of C4Orf20 corresponding to a region with amino acids TPVMIGGGVLAHTILGVAWNEITGQIKFLILDPHYTGAEDLQVILEKGWC
Assay Information C4ORF20 Blocking Peptide, catalog no. 33R-9238, is also available for use as a blocking control in assays to test for specificity of this C4ORF20 antibody


Western Blot analysis using C4ORF20 antibody (70R-3548)

C4ORF20 antibody (70R-3548) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C4ORF20 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C4ORF20 is a thiol protease which recognises and hydrolyzes the peptide bond at the C-terminal Gly of UFM1, an ubiquitin-like modifier protein bound to a number of target proteins. Does not hydrolyze SUMO1 or ISG15 ubiquitin-like proteins.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C4ORF20 antibody (70R-3548) | C4ORF20 antibody (70R-3548) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors