C4ORF33 antibody (70R-4121)

Rabbit polyclonal C4ORF33 antibody raised against the C terminal Of C4Orf33

Synonyms Polyclonal C4ORF33 antibody, Anti-C4ORF33 antibody, Chromosome ORF-4 antibody, Chromosome ORF-4, Chromosome ORF 4 antibody, Chromosome 4 ORF, FLJ33703 antibody, Chromosome ORF 4
Specificity C4ORF33 antibody was raised against the C terminal Of C4Orf33
Cross Reactivity Human,Mouse
Applications WB
Immunogen C4ORF33 antibody was raised using the C terminal Of C4Orf33 corresponding to a region with amino acids PNVTKFNSFAIHGSKDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNF
Assay Information C4ORF33 Blocking Peptide, catalog no. 33R-7238, is also available for use as a blocking control in assays to test for specificity of this C4ORF33 antibody


Western Blot analysis using C4ORF33 antibody (70R-4121)

C4ORF33 antibody (70R-4121) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C4ORF33 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C4orf33 belongs to the UPF0462 family. The exact function of C4orf33 remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C4ORF33 antibody (70R-4121) | C4ORF33 antibody (70R-4121) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors