C5ORF35 antibody (70R-4192)

Rabbit polyclonal C5ORF35 antibody raised against the N terminal Of C5Orf35

Synonyms Polyclonal C5ORF35 antibody, Anti-C5ORF35 antibody, Chromosome 5 ORF, Chromosome ORF 5, MGC33648 antibody, Chromosome ORF-5 antibody, Chromosome ORF-5, Chromosome ORF 5 antibody
Specificity C5ORF35 antibody was raised against the N terminal Of C5Orf35
Cross Reactivity Human
Applications WB
Immunogen C5ORF35 antibody was raised using the N terminal Of C5Orf35 corresponding to a region with amino acids QSEILTMLPESVKSKYQDLLAVEHQGVKLRENRHQQQSTFKPEEILYKTL
Assay Information C5ORF35 Blocking Peptide, catalog no. 33R-7722, is also available for use as a blocking control in assays to test for specificity of this C5ORF35 antibody


Western Blot analysis using C5ORF35 antibody (70R-4192)

C5ORF35 antibody (70R-4192) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C5ORF35 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of C5orf35 has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C5ORF35 antibody (70R-4192) | C5ORF35 antibody (70R-4192) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors