C7ORF38 Blocking Peptide (33R-7749)

A synthetic peptide for use as a blocking control in assays to test for specificity of C7orf38 antibody, catalog no. 70R-7005

Synonyms C7ORF38 control peptide, C7ORF38 antibody Blocking Peptide, Anti-C7ORF38 Blocking Peptide, DKFZp727G131 Blocking Peptide, FLJ36794 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QTFNYYFPEEKFESLKENIWMKDPFAFQNPESIIELNLEPEEENELLQLS
Molecular Weight 66 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of C7ORF38 protein has not been widely studied, and is yet to be fully elucidated. The protein is weakly similar to transposase-like proteins in human and mouse.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors