C9ORF127 antibody (70R-1830)

Rabbit polyclonal C9ORF127 antibody raised against the C terminal Of C9Orf127

Synonyms Polyclonal C9ORF127 antibody, Anti-C9ORF127 antibody, Chromosome ORF-9, Chromosome ORF-9 antibody, NAG-5 antibody, Chromosome ORF 9 antibody, NGX6 antibody, MGC120460 antibody, Chromosome 9 ORF, RP11-112J3.10 antibody, Chromosome ORF 9
Specificity C9ORF127 antibody was raised against the C terminal Of C9Orf127
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen C9ORF127 antibody was raised using the C terminal Of C9Orf127 corresponding to a region with amino acids FLLPPRAKTDHGVPSGARARGCGYQLCINEQEELGLVGPGGATVSSICAS
Assay Information C9ORF127 Blocking Peptide, catalog no. 33R-2971, is also available for use as a blocking control in assays to test for specificity of this C9ORF127 antibody

Images

Western Blot analysis using C9ORF127 antibody (70R-1830)

C9ORF127 antibody (70R-1830) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of C9ORF127 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Overexpression of C9orf127 can influence the distribution of the cell cycle in NPC cells and it also plays a role in cell adhesion modulation in NPC cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C9ORF127 antibody (70R-1830) | C9ORF127 antibody (70R-1830) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors