C9ORF138 antibody (70R-3538)

Rabbit polyclonal C9ORF138 antibody raised against the N terminal Of C9Orf138

Synonyms Polyclonal C9ORF138 antibody, Anti-C9ORF138 antibody, MGC35182 antibody, Chromosome ORF 9 antibody, FLJ35283 antibody, Chromosome 9 ORF, Chromosome ORF 9, Chromosome ORF-9, Chromosome ORF-9 antibody
Specificity C9ORF138 antibody was raised against the N terminal Of C9Orf138
Cross Reactivity Human
Applications WB
Immunogen C9ORF138 antibody was raised using the N terminal Of C9Orf138 corresponding to a region with amino acids SEYTENYPFYHSYLPRESFKPRREYQKGSIPMEGLTTSRRDFGPHKVAPV
Assay Information C9ORF138 Blocking Peptide, catalog no. 33R-8413, is also available for use as a blocking control in assays to test for specificity of this C9ORF138 antibody


Western Blot analysis using C9ORF138 antibody (70R-3538)

C9ORF138 antibody (70R-3538) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C9ORF138 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 9 ORF protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C9ORF138 antibody (70R-3538) | C9ORF138 antibody (70R-3538) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors