CACNA1G antibody (70R-5150)

Rabbit polyclonal CACNA1G antibody raised against the middle region of CACNA1G

Synonyms Polyclonal CACNA1G antibody, Anti-CACNA1G antibody, MGC117234 antibody, Cav3.1 antibody, CACNA 1 antibody, Calcium Channel Voltage-Dependent T Type Alpha 1G Subunit antibody, CACNA 1, CACNA-1, Ca(V)T.1 antibody, CACNA-1 antibody, NBR13 antibody, CACNA1
Specificity CACNA1G antibody was raised against the middle region of CACNA1G
Cross Reactivity Human
Applications WB
Immunogen CACNA1G antibody was raised using the middle region of CACNA1G corresponding to a region with amino acids VSRTHSLPNDSYMCRHGSTAEGPLGHRGWGLPKAQSGSVLSVHSQPADTS
Assay Information CACNA1G Blocking Peptide, catalog no. 33R-9823, is also available for use as a blocking control in assays to test for specificity of this CACNA1G antibody


Western Blot analysis using CACNA1G antibody (70R-5150)

CACNA1G antibody (70R-5150) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 241 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CACNA1G antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Voltage-activated calcium channels can be distinguished based on their voltage-dependence, deactivation, and single-channel conductance.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CACNA1G antibody (70R-5150) | CACNA1G antibody (70R-5150) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors