CACNB1 antibody (70R-5073)

Rabbit polyclonal CACNB1 antibody raised against the C terminal of CACNB1

Synonyms Polyclonal CACNB1 antibody, Anti-CACNB1 antibody, CCHLB1 antibody, CACNB1, CACNB-1, Calcium Channel Voltage-Dependent Beta 1 Subunit antibody, CACNB 1, CAB1 antibody, CACNLB1 antibody, CACNB-1 antibody, CACNB 1 antibody, MGC41896 antibody
Specificity CACNB1 antibody was raised against the C terminal of CACNB1
Cross Reactivity Human
Applications WB
Immunogen CACNB1 antibody was raised using the C terminal of CACNB1 corresponding to a region with amino acids RTMATAALAASPAPVSNLQVQVLTSLRRNLGFWGGLESSQRGSVVPQEQE
Assay Information CACNB1 Blocking Peptide, catalog no. 33R-8231, is also available for use as a blocking control in assays to test for specificity of this CACNB1 antibody


Western Blot analysis using CACNB1 antibody (70R-5073)

CACNB1 antibody (70R-5073) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CACNB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CACNB1 belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CACNB1 antibody (70R-5073) | CACNB1 antibody (70R-5073) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors