CACNB2 antibody (70R-1508)

Rabbit polyclonal CACNB2 antibody raised against the middle region of CACNB2

Synonyms Polyclonal CACNB2 antibody, Anti-CACNB2 antibody, CACNLB2 antibody, CACNB 2 antibody, CACNB-2, CACNB2, MYSB antibody, CACNB 2, CACNB-2 antibody, RP11-383B4.2 antibody, FLJ23743 antibody, Calcium Channel Voltage-Dependent Beta 2 Subunit antibody
Specificity CACNB2 antibody was raised against the middle region of CACNB2
Cross Reactivity Human
Applications WB
Immunogen CACNB2 antibody was raised using the middle region of CACNB2 corresponding to a region with amino acids ACEHLADYLEAYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGS
Assay Information CACNB2 Blocking Peptide, catalog no. 33R-1066, is also available for use as a blocking control in assays to test for specificity of this CACNB2 antibody

Images

Western Blot analysis using CACNB2 antibody (70R-1508)

CACNB2 antibody (70R-1508) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CACNB2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CACNB2 is a subunit of voltage-dependent calcium (Ca2+) channels, expressed in the CNS. It appears to serve an obligatory function.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CACNB2 antibody (70R-1508) | CACNB2 antibody (70R-1508) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors