CACNG4 antibody (70R-1535)
Rabbit polyclonal CACNG4 antibody raised against the N terminal of CACNG4
Overview
Overview
Synonyms | Polyclonal CACNG4 antibody, Anti-CACNG4 antibody, CACNG 4 antibody, CACNG-4 antibody, CACNG-4, CACNG4, CACNG 4, Calcium Channel Voltage-Dependent Gamma Subunit 4 antibody |
---|---|
Specificity | CACNG4 antibody was raised against the N terminal of CACNG4 |
Cross Reactivity | Human,Mouse,Rat,Dog |
Applications | WB |
Immunogen | CACNG4 antibody was raised using the N terminal of CACNG4 corresponding to a region with amino acids GPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYL |
Assay Information | CACNG4 Blocking Peptide, catalog no. 33R-3480, is also available for use as a blocking control in assays to test for specificity of this CACNG4 antibody |
Images
Western Blot analysis using CACNG4 antibody (70R-1535)
CACNG4 antibody (70R-1535) used at 0.31 ug/ml to detect target protein.
Specifications
Host | Rabbit |
---|---|
Method of Purification | Total IgG Protein A purified |
Molecular Weight | 36 kDa (MW of target protein) |
Form & Buffer | Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CACNG4 antibody in PBS |
Concentration | 1 mg/ml |
Usage & Assay Information
Usage Recommendations | WB: 0.31 ug/ml |
---|
Storage & Safety
Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
---|
General Information
Biological Significance | L-type calcium channels are composed of five subunits. CACNG4 represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. This gene is a member of the neuronal calcium channel gamma subunit geneubfamily of the PMP-22/EMP/MP20 family.L-type calcium channels are composed of five subunits. |
---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product