Cacng8 Blocking Peptide (33R-10347)

A synthetic peptide for use as a blocking control in assays to test for specificity of Cacng8 antibody, catalog no. 70R-8073

Synonyms Cacng8 control peptide, Cacng8 antibody Blocking Peptide, Anti-Cacng8 Blocking Peptide, calcium channel, voltage-dependent, gamma subunit 8 Blocking Peptide, Cacng8, Cacng-8, Cacng 8, Cacng-8 Blocking Peptide, Cacng 8 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ISANAGEPGPKRDEEKKNHYSYGWSFYFGGLSFILAEVIGVLAVNIYIER
Molecular Weight 43 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Cacng8 regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). It promotes their targeting to the cell membrane and synapses and modulates their gating properties by slowing their rates of activation, deactivation and desensitization and by mediating their resensitization. Cacng8 does not show subunit-specific AMPA receptor regulation and regulates all AMPAR subunits. Cacng8 is thought to stabilize the calcium channel in an inactivated (closed) state.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors