CAD antibody (70R-2048)

Rabbit polyclonal CAD antibody raised against the N terminal of CAD

Synonyms Polyclonal CAD antibody, Anti-CAD antibody, Carbamoyl-Phosphate Synthetase 2 Aspartate Transcarbamylase And Dihydroorotase antibody
Specificity CAD antibody was raised against the N terminal of CAD
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CAD antibody was raised using the N terminal of CAD corresponding to a region with amino acids AALVLEDGSVLRGQPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILV
Assay Information CAD Blocking Peptide, catalog no. 33R-1037, is also available for use as a blocking control in assays to test for specificity of this CAD antibody


Western Blot analysis using CAD antibody (70R-2048)

CAD antibody (70R-2048) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 243 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CAD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CAD is a trifunctional protein which is associated with the enzymatic activities of the first 3 enzymes in the 6-step pathway of pyrimidine biosynthesis: carbamoylphosphate synthetase (CPS II), aspartate transcarbamoylase, and dihydroorotase. This protein is regulated by the mitogen-activated protein kinase (MAPK) cascade, which indicates a direct link between activation of the MAPK cascade and de novo biosynthesis of pyrimidine nucleotides.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CAD antibody (70R-2048) | CAD antibody (70R-2048) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €352.82
Size: 50 ug
View Our Distributors