CAD antibody (70R-3216)

Rabbit polyclonal CAD antibody raised against the middle region of CAD

Synonyms Polyclonal CAD antibody, Anti-CAD antibody, cd antibody, Dmel_CG1759 antibody, Cad antibody, Carbamoyl-Phosphate Synthetase 2 Aspartate Transcarbamylase And Dihydroorotase antibody, CG1759 antibody, S67 antibody, 38E.19 antibody
Specificity CAD antibody was raised against the middle region of CAD
Cross Reactivity Drosophila
Applications WB
Immunogen CAD antibody was raised using the middle region of CAD corresponding to a region with amino acids SVSNNNRTSPSKPPYFDWMKKPAYPAQPQPGKTRTKDKYRVVYTDFQRLE
Assay Information CAD Blocking Peptide, catalog no. 33R-8934, is also available for use as a blocking control in assays to test for specificity of this CAD antibody


Western blot analysis using CAD antibody (70R-3216)

Recommended cad Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CAD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Cad regulates embryonic abdominal segment formation by zygotically activating expression of knirps (kni) and giant (gt). It plays a role in the establishment of the hindgut and in the invagination of the hindgut primordium during gastrulation. These effects on the gut are achieved by acting combinatorially at the posterior of the embryo to activate transcription of different targets, including folded gastrulation (fog), fork head (fkh) and wingless (wg).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using CAD antibody (70R-3216) | Recommended cad Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors