TMEM166 Blocking Peptide (33R-1036)

A synthetic peptide for use as a blocking control in assays to test for specificity of CAD antibody, catalog no. 70R-2048

Synonyms CAD control peptide, CAD antibody Blocking Peptide, Anti-CAD Blocking Peptide, Carbamoyl-Phosphate Synthetase 2 Aspartate Transcarbamylase And Dihydroorotase Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AALVLEDGSVLRGQPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILV
Molecular Weight 243 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CAD is a trifunctional protein which is associated with the enzymatic activities of the first 3 enzymes in the 6-step pathway of pyrimidine biosynthesis: carbamoylphosphate synthetase (CPS II), aspartate transcarbamoylase, and dihydroorotase. This protein is regulated by the mitogen-activated protein kinase (MAPK) cascade, which indicates a direct link between activation of the MAPK cascade and de novo biosynthesis of pyrimidine nucleotides.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €113.70
Size: 100 ug
OR
Shipping
View Our Distributors