TMEM166 Blocking Peptide (33R-1036)
A synthetic peptide for use as a blocking control in assays to test for specificity of CAD antibody, catalog no. 70R-2048
Overview
Overview
| Synonyms | CAD control peptide, CAD antibody Blocking Peptide, Anti-CAD Blocking Peptide, Carbamoyl-Phosphate Synthetase 2 Aspartate Transcarbamylase And Dihydroorotase Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AALVLEDGSVLRGQPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILV |
|---|---|
| Molecular Weight | 243 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | CAD is a trifunctional protein which is associated with the enzymatic activities of the first 3 enzymes in the 6-step pathway of pyrimidine biosynthesis: carbamoylphosphate synthetase (CPS II), aspartate transcarbamoylase, and dihydroorotase. This protein is regulated by the mitogen-activated protein kinase (MAPK) cascade, which indicates a direct link between activation of the MAPK cascade and de novo biosynthesis of pyrimidine nucleotides. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product