Caldesmon 1 antibody (70R-3420)

Rabbit polyclonal Caldesmon 1 antibody raised against the C terminal of CALD1

Synonyms Polyclonal Caldesmon 1 antibody, Anti-Caldesmon 1 antibody, L-CAD antibody, MGC21352 antibody, NAG22 antibody, CALD1 antibody, H-CAD antibody, CDM antibody
Specificity Caldesmon 1 antibody was raised against the C terminal of CALD1
Cross Reactivity Human
Applications WB
Immunogen Caldesmon 1 antibody was raised using the C terminal of CALD1 corresponding to a region with amino acids VLEEEEQRRKQEEADRKLREEEEKRRLKEEIERRRAEAAEKRQKMPEDGL
Assay Information Caldesmon 1 Blocking Peptide, catalog no. 33R-9647, is also available for use as a blocking control in assays to test for specificity of this Caldesmon 1 antibody


Western Blot analysis using Caldesmon 1 antibody (70R-3420)

Caldesmon 1 antibody (70R-3420) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 93 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CALD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CALD1 is a calmodulin- and actin-binding protein that plays an essential role in the regulation of smooth muscle and nonmuscle contraction. The conserved domain of this protein possesses the binding activities to Ca(2+)-calmodulin, actin, tropomyosin, myosin, and phospholipids.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Caldesmon 1 antibody (70R-3420) | Caldesmon 1 antibody (70R-3420) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors