Calpain 4 antibody (70R-3500)

Rabbit polyclonal Calpain 4 antibody raised against the middle region of CAPNS1

Synonyms Polyclonal Calpain 4 antibody, Anti-Calpain 4 antibody, CAPN4 antibody, CALPAIN4 antibody, 30K antibody, Calpain Small Subunit 1 antibody, CDPS antibody, CAPNS1 antibody, CANPS antibody, CANP antibody
Specificity Calpain 4 antibody was raised against the middle region of CAPNS1
Cross Reactivity Human
Applications WB
Immunogen Calpain 4 antibody was raised using the middle region of CAPNS1 corresponding to a region with amino acids RRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQL
Assay Information Calpain 4 Blocking Peptide, catalog no. 33R-8169, is also available for use as a blocking control in assays to test for specificity of this Calpain 4 antibody

Images

Western Blot analysis using Calpain 4 antibody (70R-3500)

Calpain 4 antibody (70R-3500) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CAPNS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Calpains are a ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. Calpain families have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. Calpain I and II are heterodimeric with distinct large subunits associated with common small subunits, all of which are encoded by different genes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Calpain 4 antibody (70R-3500) | Calpain 4 antibody (70R-3500) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors