CAMK1G antibody (70R-4089)

Rabbit polyclonal CAMK1G antibody raised against the middle region of CAMK1G

Synonyms Polyclonal CAMK1G antibody, Anti-CAMK1G antibody, CLICKIII antibody, VWS1 antibody, dJ272L16.1 antibody, CAMK1G antibody, Calcium/Calmodulin-Dependent Protein Kinase Ig antibody
Specificity CAMK1G antibody was raised against the middle region of CAMK1G
Cross Reactivity Human
Applications WB
Immunogen CAMK1G antibody was raised using the middle region of CAMK1G corresponding to a region with amino acids KDFICHLLEKDPNERYTCEKALSHPWIDGNTALHRDIYPSVSLQIQKNFA
Assay Information CAMK1G Blocking Peptide, catalog no. 33R-4285, is also available for use as a blocking control in assays to test for specificity of this CAMK1G antibody


Western Blot analysis using CAMK1G antibody (70R-4089)

CAMK1G antibody (70R-4089) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CAMK1G antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a protein similar to calcium/calmodulin dependent protein kinase, however, its exact function is not known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CAMK1G antibody (70R-4089) | CAMK1G antibody (70R-4089) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors