CAMK2D Blocking Peptide (33R-10328)

A synthetic peptide for use as a blocking control in assays to test for specificity of CAMK2D antibody, catalog no. 70R-10320

Synonyms CAMK2D control peptide, CAMK2D antibody Blocking Peptide, Anti-CAMK2D Blocking Peptide, calcium/calmodulin-dependent protein kinase II delta Blocking Peptide, CAMKD Blocking Peptide, DKFZp686G23119 Blocking Peptide, DKFZp686I2288 Blocking Peptide, MGC44911 Blocking Peptide, CAMK2D, CAMKD-2, CAMKD 2, CAMKD-2 Blocking Peptide, CAMKD 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues GAILTTMLATRNFSAAKSLLKKPDGVKESTESSNTTIEDEDVKARKQEII
Molecular Weight 53 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The product of this gene belongs to the serine/threonine protein kinase family and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells, the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a delta chain. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Distinct isoforms of this chain have different expression patterns.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors