CAND2 Blocking Peptide (33R-6518)

A synthetic peptide for use as a blocking control in assays to test for specificity of CAND2 antibody, catalog no. 70R-8933

Synonyms CAND2 control peptide, CAND2 antibody Blocking Peptide, Anti-CAND2 Blocking Peptide, cullin-associated and neddylation-dissociated 2, putative Blocking Peptide, KIAA0667 Blocking Peptide, TIP120B Blocking Peptide, Tp120b Blocking Peptide, CAND2, CAND-2, CAND 2, CAND-2 Blocking Peptide, CAND 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MSTAAFHISSLLEKMTSSDKDFRFMATSDLMSELQKDSIQLDEDSERKVV
Molecular Weight 123 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CAND2 may play a role in the assembly of ubiquitin ligase complexes and modulate the ubiquitination of target proteins. And it may be also a transcription regulator.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors