CAND2 Blocking Peptide (33R-6518)
A synthetic peptide for use as a blocking control in assays to test for specificity of CAND2 antibody, catalog no. 70R-8933
Overview
Overview
| Synonyms | CAND2 control peptide, CAND2 antibody Blocking Peptide, Anti-CAND2 Blocking Peptide, cullin-associated and neddylation-dissociated 2, putative Blocking Peptide, KIAA0667 Blocking Peptide, TIP120B Blocking Peptide, Tp120b Blocking Peptide, CAND2, CAND-2, CAND 2, CAND-2 Blocking Peptide, CAND 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MSTAAFHISSLLEKMTSSDKDFRFMATSDLMSELQKDSIQLDEDSERKVV |
|---|---|
| Molecular Weight | 123 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | CAND2 may play a role in the assembly of ubiquitin ligase complexes and modulate the ubiquitination of target proteins. And it may be also a transcription regulator. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product