CANT1 Blocking Peptide (33R-8666)
A synthetic peptide for use as a blocking control in assays to test for specificity of CANT1 antibody, catalog no. 70R-5808
Overview
Overview
| Synonyms | CANT1 control peptide, CANT1 antibody Blocking Peptide, Anti-CANT1 Blocking Peptide, Calcium Activated Nucleotidase 1 Blocking Peptide, SCAN-1 Blocking Peptide, SHAPY Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASY |
|---|---|
| Molecular Weight | 45 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | CANT1 belongs to the apyrase family.It is a calcium-dependent nucleotidase with a preference for UDP. The order of activity with different substrates is UDP > GDP > UTP > GTP. The enzyme has very low activity towards ADP and even lower activity towards ATP. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product