CANT1 Blocking Peptide (33R-8666)

A synthetic peptide for use as a blocking control in assays to test for specificity of CANT1 antibody, catalog no. 70R-5808

Synonyms CANT1 control peptide, CANT1 antibody Blocking Peptide, Anti-CANT1 Blocking Peptide, Calcium Activated Nucleotidase 1 Blocking Peptide, SCAN-1 Blocking Peptide, SHAPY Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASY
Molecular Weight 45 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CANT1 belongs to the apyrase family.It is a calcium-dependent nucleotidase with a preference for UDP. The order of activity with different substrates is UDP > GDP > UTP > GTP. The enzyme has very low activity towards ADP and even lower activity towards ATP.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors