CAPS antibody (70R-5864)

Rabbit polyclonal CAPS antibody raised against the N terminal of CAPS

Synonyms Polyclonal CAPS antibody, Anti-CAPS antibody, CAPS1 antibody, MGC126562 antibody, Calcyphosine antibody
Specificity CAPS antibody was raised against the N terminal of CAPS
Cross Reactivity Human
Applications WB
Immunogen CAPS antibody was raised using the N terminal of CAPS corresponding to a region with amino acids DAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLA
Assay Information CAPS Blocking Peptide, catalog no. 33R-1864, is also available for use as a blocking control in assays to test for specificity of this CAPS antibody

Images

Western Blot analysis using CAPS antibody (70R-5864)

CAPS antibody (70R-5864) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CAPS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CAPS is a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CAPS antibody (70R-5864) | CAPS antibody (70R-5864) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors