CAPS Blocking Peptide (33R-1864)
A synthetic peptide for use as a blocking control in assays to test for specificity of CAPS antibody, catalog no. 70R-5864
Overview
Overview
| Synonyms | CAPS control peptide, CAPS antibody Blocking Peptide, Anti-CAPS Blocking Peptide, Calcyphosine Blocking Peptide, CAPS1 Blocking Peptide, MGC126562 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | DAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLA |
|---|---|
| Molecular Weight | 21 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | CAPS is a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product