CAPS Blocking Peptide (33R-1864)

A synthetic peptide for use as a blocking control in assays to test for specificity of CAPS antibody, catalog no. 70R-5864

Synonyms CAPS control peptide, CAPS antibody Blocking Peptide, Anti-CAPS Blocking Peptide, Calcyphosine Blocking Peptide, CAPS1 Blocking Peptide, MGC126562 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues DAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLA
Molecular Weight 21 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CAPS is a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors