CAPZA3 antibody (70R-3348)

Rabbit polyclonal CAPZA3 antibody

Synonyms Polyclonal CAPZA3 antibody, Anti-CAPZA3 antibody, Capping Protein antibody, Gsg3 antibody, CAPPA3 antibody, Actin Filament Muscle Z-Line Alpha 3 antibody
Cross Reactivity Human
Applications WB
Immunogen CAPZA3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTLSVLSRKDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGEC
Assay Information CAPZA3 Blocking Peptide, catalog no. 33R-6555, is also available for use as a blocking control in assays to test for specificity of this CAPZA3 antibody


Western Blot analysis using CAPZA3 antibody (70R-3348)

CAPZA3 antibody (70R-3348) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CAPZA3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance F-actin-capping proteins bind in a Ca2+-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments. CAPZA3 may play a role in the morphogenesis of spermatid.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CAPZA3 antibody (70R-3348) | CAPZA3 antibody (70R-3348) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors