Carbonic Anhydrase IV antibody (70R-1862)

Rabbit polyclonal Carbonic Anhydrase IV antibody raised against the middle region of CA4

Synonyms Polyclonal Carbonic Anhydrase IV antibody, Anti-Carbonic Anhydrase IV antibody, CAIV antibody, RP17 antibody, CA4 antibody, Car4 antobody
Specificity Carbonic Anhydrase IV antibody was raised against the middle region of CA4
Cross Reactivity Human
Applications WB
Immunogen Carbonic Anhydrase IV antibody was raised using the middle region of CA4 corresponding to a region with amino acids DGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGF
Assay Information Carbonic Anhydrase IV Blocking Peptide, catalog no. 33R-1946, is also available for use as a blocking control in assays to test for specificity of this Carbonic Anhydrase IV antibody


Western Blot analysis using Carbonic Anhydrase IV antibody (70R-1862)

Carbonic Anhydrase IV antibody (70R-1862) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CA4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA IV is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known, however, it may have a role in inherited renal abnormalities of bicarbonate transport.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Carbonic Anhydrase IV antibody (70R-1862) | Carbonic Anhydrase IV antibody (70R-1862) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors