Carbonic Anhydrase Vb antibody (Mitochondrial) (70R-4459)

Rabbit polyclonal Carbonic Anhydrase Vb antibody (Mitochondrial) raised against the N terminal of CA5B

Synonyms Polyclonal Carbonic Anhydrase Vb antibody (Mitochondrial), Anti-Carbonic Anhydrase Vb antibody (Mitochondrial), Car5 antibody, MGC39962 antibody, CA-VB antibody, CA5B antibody
Specificity Carbonic Anhydrase Vb antibody (Mitochondrial) was raised against the N terminal of CA5B
Cross Reactivity Human
Applications WB
Immunogen Carbonic Anhydrase Vb antibody (Mitochondrial) was raised using the N terminal of CA5B corresponding to a region with amino acids WRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPL
Assay Information Carbonic Anhydrase Vb Blocking Peptide (Mitochondrial), catalog no. 33R-9998, is also available for use as a blocking control in assays to test for specificity of this Carbonic Anhydrase Vb antibody (Mitochondrial)


Western Blot analysis using Carbonic Anhydrase Vb antibody (Mitochondrial) (70R-4459)

Carbonic Anhydrase Vb antibody (Mitochondrial) (70R-4459) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CA5B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA VB is localized in the mitochondria and shows the highest sequence similarity to the other mitochondrial CA, CA VA. It has a wider tissue distribution than CA VA, which is restricted to the liver. The differences in tissue distribution suggest that the two mitochondrial carbonic anhydrases evolved to assume different physiologic roles.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Carbonic Anhydrase Vb antibody (Mitochondrial) (70R-4459) | Carbonic Anhydrase Vb antibody (Mitochondrial) (70R-4459) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors