Carbonyl Reductase 1 antibody (70R-1026)

Rabbit polyclonal Carbonyl Reductase 1 antibody raised against the C terminal of CBR1

Synonyms Polyclonal Carbonyl Reductase 1 antibody, Anti-Carbonyl Reductase 1 antibody, CBR1 antibody, CBR antibody, Carbonyl Reductase 1 antibody, Carbonyl Reductase -1, hCBR1 antibody, Carbonyl Reductase -1 antibody, Carbonyl Reductase 1, Carbonyl Reductase 1
Specificity Carbonyl Reductase 1 antibody was raised against the C terminal of CBR1
Cross Reactivity Human,Mouse
Applications WB
Immunogen Carbonyl Reductase 1 antibody was raised using the C terminal of CBR1 corresponding to a region with amino acids PGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
Assay Information Carbonyl Reductase 1 Blocking Peptide, catalog no. 33R-7140, is also available for use as a blocking control in assays to test for specificity of this Carbonyl Reductase 1 antibody

Images

Western Blot analysis using Carbonyl Reductase 1 antibody (70R-1026)

Carbonyl Reductase 1 antibody (70R-1026) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CBR1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Carbonyl reductase is one of several monomeric, NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues. Another carbonyl reductase gene, CRB3, lies close to this gene on chromosome 21q.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Carbonyl Reductase 1 antibody (70R-1026) | Carbonyl Reductase 1 antibody (70R-1026) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors