Carboxyl Ester Lipase antibody (70R-5366)

Rabbit polyclonal Carboxyl Ester Lipase antibody

Synonyms Polyclonal Carboxyl Ester Lipase antibody, Anti-Carboxyl Ester Lipase antibody, LIPA antibody, CEL antibody, FAPP antibody, BAL antibody, CEase antibody, FAP antibody, CELL antibody, BSSL antibody, Bile Salt-Stimulated Lipase antibody, BSDL antibody, MODY8 antibody
Cross Reactivity Human
Applications WB
Immunogen Carboxyl Ester Lipase antibody was raised using a synthetic peptide corresponding to a region with amino acids VTPTGDSETAPVPPTGDSGAPPVPPTGDSEAAPVPPTDDSKEAQMPAVIR
Assay Information Carboxyl Ester Lipase Blocking Peptide, catalog no. 33R-9855, is also available for use as a blocking control in assays to test for specificity of this Carboxyl Ester Lipase antibody


Western Blot analysis using Carboxyl Ester Lipase antibody (70R-5366)

Carboxyl Ester Lipase antibody (70R-5366) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 80 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CEL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CEL catalyzes fat and vitamin absorption. CEL acts in concert with pancreatic lipase and colipase for the complete digestion of dietary triglycerides.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Carboxyl Ester Lipase antibody (70R-5366) | Carboxyl Ester Lipase antibody (70R-5366) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors