Carboxylesterase 1 antibody (70R-1223)

Rabbit polyclonal Carboxylesterase 1 antibody

Synonyms Polyclonal Carboxylesterase 1 antibody, Anti-Carboxylesterase 1 antibody, CES2 antibody, Carboxylesterase 1, Monocyte/Macrophage Serine Esterase 1 antibody, HMSE1 antibody, SES1 antibody, CES1 antibody, Carboxylesterase 1, HMSE antibody, CEH antibody, Carboxylesterase -1, Carboxylesterase -1 antibody, Carboxylesterase 1 antibody
Cross Reactivity Human
Applications WB
Immunogen Carboxylesterase 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNL
Assay Information Carboxylesterase 1 Blocking Peptide, catalog no. 33R-1397, is also available for use as a blocking control in assays to test for specificity of this Carboxylesterase 1 antibody


Western Blot analysis using Carboxylesterase 1 antibody (70R-1223)

Carboxylesterase 1 antibody (70R-1223) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CES1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CES1 is one of the enzymes responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. This enzyme is known to hydrolyze aromatic and aliphatic esters and is necessary for cellular cholesterol esterification. It may also play a role in detoxification in the lung and/or protection of the central nervous system from ester or amide compounds. Carboxylesterase deficiency may be associated with non-Hodgkin lymphoma or B-cell lymphocytic leukemia.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Carboxylesterase 1 antibody (70R-1223) | Carboxylesterase 1 antibody (70R-1223) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors