Carboxylesterase 7 antibody (70R-5468)

Rabbit polyclonal Carboxylesterase 7 antibody raised against the N terminal of CES7

Synonyms Polyclonal Carboxylesterase 7 antibody, Anti-Carboxylesterase 7 antibody, Carboxylesterase 7, FLJ31547 antibody, CES5 antibody, CES4C1 antibody, Carboxylesterase -7 antibody, Carboxylesterase 7 antibody, Carboxylesterase -7, CAUXIN antibody, CES7 antibody, Carboxylesterase 7
Specificity Carboxylesterase 7 antibody was raised against the N terminal of CES7
Cross Reactivity Human
Applications WB
Immunogen Carboxylesterase 7 antibody was raised using the N terminal of CES7 corresponding to a region with amino acids SGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSP
Assay Information Carboxylesterase 7 Blocking Peptide, catalog no. 33R-8476, is also available for use as a blocking control in assays to test for specificity of this Carboxylesterase 7 antibody


Western Blot analysis using Carboxylesterase 7 antibody (70R-5468)

Carboxylesterase 7 antibody (70R-5468) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CES7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CES7 belongs to the type-B carboxylesterase/lipase family. It is involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Carboxylesterase 7 antibody (70R-5468) | Carboxylesterase 7 antibody (70R-5468) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors