Carboxypeptidase X antibody (70R-3990)

Rabbit polyclonal Carboxypeptidase X antibody

Synonyms Polyclonal Carboxypeptidase X antibody, Anti-Carboxypeptidase X antibody, CPXM1 antibody, M14 Family 1 antibody, CPX1 antibody, CPXM antibody
Cross Reactivity Human
Applications WB
Immunogen Carboxypeptidase X antibody was raised using a synthetic peptide corresponding to a region with amino acids MNDFSYLHTNCFEVTVELSCDKFPHENELPQEWENNKDALLTYLEQVRMG
Assay Information Carboxypeptidase X Blocking Peptide, catalog no. 33R-6241, is also available for use as a blocking control in assays to test for specificity of this Carboxypeptidase X antibody


Western Blot analysis using Carboxypeptidase X antibody (70R-3990)

Carboxypeptidase X antibody (70R-3990) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 80 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CPXM1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene likely encodes a member of the carboxypeptidase family of proteins. Cloning of a comparable locus in mouse indicates that the encoded protein contains a discoidin domain and a carboxypeptidase domain, but the protein appears to lack residues necessary for carboxypeptidase activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Carboxypeptidase X antibody (70R-3990) | Carboxypeptidase X antibody (70R-3990) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors