CARS antibody (70R-5006)

Rabbit polyclonal CARS antibody raised against the N terminal of CARS

Synonyms Polyclonal CARS antibody, Anti-CARS antibody, Cysteinyl-tRNA Synthetase antibody, CYSRS antibody, CARS1 antibody, MGC:11246 antibody
Specificity CARS antibody was raised against the N terminal of CARS
Cross Reactivity Human
Applications WB
Immunogen CARS antibody was raised using the N terminal of CARS corresponding to a region with amino acids MQTPPLQQPHQEQVFLAFLVIVIPSFLTKEVFIPQDGKKVTWYCCGPTVY
Assay Information CARS Blocking Peptide, catalog no. 33R-6347, is also available for use as a blocking control in assays to test for specificity of this CARS antibody


Western Blot analysis using CARS antibody (70R-5006)

CARS antibody (70R-5006) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 84 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CARS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CARS is a class 1 aminoacyl-tRNA synthetase, cysteinyl-tRNA synthetase. Each of the twenty aminoacyl-tRNA synthetases catalyzes the aminoacylation of a specific tRNA or tRNA isoaccepting family with the cognate amino acid. This gene is one of several located near the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CARS antibody (70R-5006) | CARS antibody (70R-5006) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors