CASP8AP2 Blocking Peptide (33R-8602)
A synthetic peptide for use as a blocking control in assays to test for specificity of CASP8AP2 antibody, catalog no. 70R-8932
Overview
Overview
| Synonyms | CASP8AP2 control peptide, CASP8AP2 antibody Blocking Peptide, Anti-CASP8AP2 Blocking Peptide, CASP8 associated protein 2 Blocking Peptide, CED-4 Blocking Peptide, FLASH Blocking Peptide, FLJ11208 Blocking Peptide, KIAA1315 Blocking Peptide, RIP25 Blocking Peptide, CASP8AP2, CASPAP2-8, CASPAP2 8, CASPAP2-8 Blocking Peptide, CASPAP2 8 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SLKKNISALIKTARVEINRKDEEISNLHQRLSEFPHFRNNHKTARTFDTV |
|---|---|
| Molecular Weight | 223 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | CASP8AP2 is highly similar to FLASH, a mouse apoptotic protein identified by its interaction with the death-effector domain (DED) of caspase 8. Studies of FLASH protein suggested that this protein may be a component of the death-inducing signaling complex that includes Fas receptor, Fas-binding adapter FADD, and caspase 8, and plays a regulatory role in Fas-mediated apoptosis. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product