MGC42174 antibody was raised against the N terminal Of Mgc42174
Cross Reactivity
Human
Applications
IHC, WB
Immunogen
MGC42174 antibody was raised using the N terminal Of Mgc42174 corresponding to a region with amino acids WKVVKPESNDKETEAAYESDIPEELCGHHLPQQSLKSYNDSPDVIVEAQF
Assay Information
MGC42174 Blocking Peptide, catalog no. 33R-9966, is also available for use as a blocking control in assays to test for specificity of this MGC42174 antibody
Immunohistochemical staining using MGC42174 antibody (70R-1461)
MGC42174 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Heart. Magnification is at 400X
MGC42174 antibody
Immunohistochemical staining using MGC42174 antibody (70R-1461)
MGC42174 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Heart. Magnification is at 400X
Western Blot analysis using MGC42174 antibody (70R-1461)
MGC42174 antibody (70R-1461) used at 1.25 ug/ml to detect target protein.
Specifications
Host
Rabbit
Method of Purification
Total IgG Protein A purified
Molecular Weight
68 kDa (MW of target protein)
Form & Buffer
Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.