CSH1 antibody (70R-1711)

Rabbit polyclonal CSH1 antibody

Synonyms Polyclonal CSH1 antibody, Anti-CSH1 antibody, Placental Lactogen antibody, Chorionic Somatomammotropin Hormone 1 antibody
Cross Reactivity Human
Applications IHC, WB
Immunogen CSH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYS
Assay Information CSH1 Blocking Peptide, catalog no. 33R-8635, is also available for use as a blocking control in assays to test for specificity of this CSH1 antibody

Images

Immunohistochemical staining using CSH1 antibody (70R-1711)

CSH1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of fundic gland {arrows) in Human Stomach. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CSH1 is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, although the ratio of 1 to 2 increases by term. Mutations in this gene result in placental lactogen deficiency and Silver-Russell syndrome.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using CSH1 antibody (70R-1711) | CSH1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of fundic gland {arrows) in Human Stomach. Magnification is at 400X
  • Western Blot analysis using CSH1 antibody (70R-1711) | CSH1 antibody (70R-1711) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €262.58
Size: 100 ug
OR
Shipping
View Our Distributors