PTHLH antibody was raised against the middle region of PTHLH
Cross Reactivity
Human, Dog
Applications
IHC, WB
Immunogen
PTHLH antibody was raised using the middle region of PTHLH corresponding to a region with amino acids YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS
Assay Information
PTHLH Blocking Peptide, catalog no. 33R-10147, is also available for use as a blocking control in assays to test for specificity of this PTHLH antibody
Immunohistochemical staining using PTHLH antibody (70R-1717)
PTHLH antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of collecting tubule (arrows) and renal tubule (lndicated with Arrow Heads) in Human Kidney. Magnification is at 400X.
PTHLH antibody
Immunohistochemical staining using PTHLH antibody (70R-1717)
PTHLH antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of collecting tubule (arrows) and renal tubule (lndicated with Arrow Heads) in Human Kidney. Magnification is at 400X.
Western Blot analysis using PTHLH antibody (70R-1717)
PTHLH antibody (70R-1717) used at 2 ug/ml to detect target protein.
Immunohistochemical staining using PTHLH antibody (70R-1717)
PTHLH antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (lndicated with Arrows) in Human Lung. Magnification is at 400X
Specifications
Host
Rabbit
Method of Purification
Total IgG Protein A purified
Molecular Weight
20 kDa (MW of target protein)
Form & Buffer
Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
General Information
Biological Significance
PTHLH is a member of the parathyroid hormone family. This hormone regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. This hormone is involved in lactation possibly by regulating the mobilization and transfer of calcium to the milk. The receptor of this hormone, PTHR1, is responsible for most cases of humoral hypercalcemia of malignancy. Four alternatively spliced transcript variants encoding two distinct isoforms have been observed.