IFRD1 antibody (70R-1986)

Rabbit polyclonal IFRD1 antibody raised against the N terminal of IFRD1

Synonyms Polyclonal IFRD1 antibody, Anti-IFRD1 antibody, TIS7 antibody, PC4 antibody, Interferon-Related Developmental Regulator 1 antibody
Specificity IFRD1 antibody was raised against the N terminal of IFRD1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen IFRD1 antibody was raised using the N terminal of IFRD1 corresponding to a region with amino acids VQPFSDEDASIETMSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGL
Assay Information IFRD1 Blocking Peptide, catalog no. 33R-9754, is also available for use as a blocking control in assays to test for specificity of this IFRD1 antibody

Images

Western Blot analysis using IFRD1 antibody (70R-1986)

IFRD1 antibody (70R-1986) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IFRD1 belongs to the IFRD family.It could play a role in regulating gene activity in the proliferative and/or differentiative pathways induced by NGF. IFRD1 may be an autocrine factor that attenuates or amplifies the initial ligand-induced signal.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using IFRD1 antibody (70R-1986) | IFRD1 antibody (70R-1986) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €331.29
Size: 50 ug
OR
Shipping
View Our Distributors