IFRD1 antibody (70R-1986)
Rabbit polyclonal IFRD1 antibody raised against the N terminal of IFRD1
Overview
Overview
| Synonyms | Polyclonal IFRD1 antibody, Anti-IFRD1 antibody, TIS7 antibody, PC4 antibody, Interferon-Related Developmental Regulator 1 antibody |
|---|---|
| Specificity | IFRD1 antibody was raised against the N terminal of IFRD1 |
| Cross Reactivity | Human,Mouse,Rat |
| Applications | WB |
| Immunogen | IFRD1 antibody was raised using the N terminal of IFRD1 corresponding to a region with amino acids VQPFSDEDASIETMSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGL |
| Assay Information | IFRD1 Blocking Peptide, catalog no. 33R-9754, is also available for use as a blocking control in assays to test for specificity of this IFRD1 antibody |
Images
Western Blot analysis using IFRD1 antibody (70R-1986)
IFRD1 antibody (70R-1986) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 50 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | IFRD1 belongs to the IFRD family.It could play a role in regulating gene activity in the proliferative and/or differentiative pathways induced by NGF. IFRD1 may be an autocrine factor that attenuates or amplifies the initial ligand-induced signal. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product