ANTP antibody (70R-2190)
Rabbit polyclonal ANTP antibody raised against the C terminal Of Antp
Overview
Overview
| Synonyms | Polyclonal ANTP antibody, Anti-ANTP antibody, Dmel_CG1028 antibody, Ant antibody, CG1028 antibody, Scx antibody, DMANTPE1 antibody, DRO15DC96Z antibody, 3.4 antibody, Hu antibody, l(3)84Ba antibody, ANT-P antibody, AntP1 antibody, ANT-C antibody, DmAntp antibody, AntP antibody |
|---|---|
| Specificity | ANTP antibody was raised against the C terminal Of Antp |
| Cross Reactivity | Drosophila |
| Applications | WB |
| Immunogen | ANTP antibody was raised using the C terminal Of Antp corresponding to a region with amino acids QQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH |
| Assay Information | ANTP Blocking Peptide, catalog no. 33R-7700, is also available for use as a blocking control in assays to test for specificity of this ANTP antibody |
Images
Western blot analysis using ANTP antibody (70R-2190)
Recommended Antp Antibody Titration: 0.2-1 ug/ml
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 33 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 0.25 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Antp is a sequence-specific transcription factor which is part of a developmental regulatory system that regulates segmental identity in the mesothorax. It provides cells with specific positional identities on the anterior-posterior axis. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product