PIWIL2 antibody (70R-2277)
Rabbit polyclonal PIWIL2 antibody
Overview
Overview
| Synonyms | Polyclonal PIWIL2 antibody, Anti-PIWIL2 antibody, PIWIL-2 antibody, FLJ10351 antibody, PIWIL 2, PIWIL-2, PIWIL2, MGC133049 antibody, Piwi-Like 2 antibody, mili antibody, HILI antibody, PIWIL1L antibody, PIWIL 2 antibody |
|---|---|
| Cross Reactivity | Human |
| Applications | WB |
| Immunogen | PIWIL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QVLELKSQRKTDSAEISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLDM |
| Assay Information | PIWIL2 Blocking Peptide, catalog no. 33R-7778, is also available for use as a blocking control in assays to test for specificity of this PIWIL2 antibody |
Images
Western Blot analysis using PIWIL2 antibody (70R-2277)
PIWIL2 antibody (70R-2277) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 110 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | PIWIL2 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product