KIR2DL4 antibody (70R-2365)
Rabbit polyclonal KIR2DL4 antibody raised against the middle region of KIR2DL4
Overview
Overview
| Synonyms | Polyclonal KIR2DL4 antibody, Anti-KIR2DL4 antibody, KIRDL4-2, KIR2DL4, CD158D antibody, KIR103AS antibody, KIRDL4 2 antibody, KIRDL4-2 antibody, G9P antibody, KIRDL4 2, Killer Cell Immunoglobulin-Like Receptor Two Domains Long Cytoplasmic Tail 4 antibody, KIR103 antibody |
|---|---|
| Specificity | KIR2DL4 antibody was raised against the middle region of KIR2DL4 |
| Cross Reactivity | Human |
| Applications | WB |
| Immunogen | KIR2DL4 antibody was raised using the middle region of KIR2DL4 corresponding to a region with amino acids VSVTGNPSSSWPSPTEPSFKTGIARHLHAVIRYSVAIILFTILPFFLLHR |
| Assay Information | KIR2DL4 Blocking Peptide, catalog no. 33R-9831, is also available for use as a blocking control in assays to test for specificity of this KIR2DL4 antibody |
Images
Western Blot analysis using KIR2DL4 antibody (70R-2365)
KIR2DL4 antibody (70R-2365) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 30 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product