Troponin T Type 1 antibody (70R-2585)

Rabbit polyclonal Troponin T Type 1 antibody

Synonyms Polyclonal Troponin T Type 1 antibody, Anti-Troponin T Type 1 antibody, MGC104241 antibody, TNNT1 antibody, ANM antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen Troponin T Type 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids WIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK
Assay Information Troponin T Type 1 Blocking Peptide, catalog no. 33R-9957, is also available for use as a blocking control in assays to test for specificity of this Troponin T Type 1 antibody

Images

Western Blot analysis using Troponin T Type 1 antibody (70R-2585)

Troponin T Type 1 antibody (70R-2585) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TNNT1 is a protein that is a subunit of troponin, which is a regulatory complex located on the thin filament of the sarcomere. This complex regulates striated muscle contraction in response to fluctuations in intracellular calcium concentration. This complex is composed of three subunits: troponin C, which binds calcium, troponin T, which binds tropomyosin, and troponin I, which is an inhibitory subunit. This protein is the slow skeletal troponin T subunit. Mutations in this gene cause nemaline myopathy type 5, also known as Amish nemaline myopathy, a neuromuscular disorder characterized by muscle weakness and rod-shaped, or nemaline, inclusions in skeletal muscle fibers which affects infants, resulting in death due to respiratory insufficiency, usually in the second year.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Troponin T Type 1 antibody (70R-2585) | Troponin T Type 1 antibody (70R-2585) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €331.29
Size: 50 ug
OR
Shipping
View Our Distributors