Troponin T Type 1 antibody (70R-2585)
Rabbit polyclonal Troponin T Type 1 antibody
Overview
Overview
| Synonyms | Polyclonal Troponin T Type 1 antibody, Anti-Troponin T Type 1 antibody, MGC104241 antibody, TNNT1 antibody, ANM antibody |
|---|---|
| Cross Reactivity | Human,Mouse |
| Applications | WB |
| Immunogen | Troponin T Type 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids WIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK |
| Assay Information | Troponin T Type 1 Blocking Peptide, catalog no. 33R-9957, is also available for use as a blocking control in assays to test for specificity of this Troponin T Type 1 antibody |
Images
Western Blot analysis using Troponin T Type 1 antibody (70R-2585)
Troponin T Type 1 antibody (70R-2585) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 33 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | TNNT1 is a protein that is a subunit of troponin, which is a regulatory complex located on the thin filament of the sarcomere. This complex regulates striated muscle contraction in response to fluctuations in intracellular calcium concentration. This complex is composed of three subunits: troponin C, which binds calcium, troponin T, which binds tropomyosin, and troponin I, which is an inhibitory subunit. This protein is the slow skeletal troponin T subunit. Mutations in this gene cause nemaline myopathy type 5, also known as Amish nemaline myopathy, a neuromuscular disorder characterized by muscle weakness and rod-shaped, or nemaline, inclusions in skeletal muscle fibers which affects infants, resulting in death due to respiratory insufficiency, usually in the second year. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product