IMPA2 antibody (70R-2599)
Rabbit polyclonal IMPA2 antibody raised against the middle region of IMPA2
Overview
Overview
| Synonyms | Polyclonal IMPA2 antibody, Anti-IMPA2 antibody, Inositol antibody, Myo-1 antibody, IMPA antibody |
|---|---|
| Specificity | IMPA2 antibody was raised against the middle region of IMPA2 |
| Cross Reactivity | Human |
| Applications | WB |
| Immunogen | IMPA2 antibody was raised using the middle region of IMPA2 corresponding to a region with amino acids RGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLH |
| Assay Information | IMPA2 Blocking Peptide, catalog no. 33R-7934, is also available for use as a blocking control in assays to test for specificity of this IMPA2 antibody |
Images
Western Blot analysis using IMPA2 antibody (70R-2599)
IMPA2 antibody (70R-2599) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 32 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | IMPA2 belongs to the inositol monophosphatase family. The present study suggests that a promoter haplotype of IMPA2 possibly contributes to risk for bipolar disorder by elevating IMPA2 levels in the brain, albeit the genetic effect varies among populations. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product