NARG1L antibody (70R-2694)
Rabbit polyclonal NARG1L antibody raised against the middle region of NARG1L
Overview
Overview
| Synonyms | Polyclonal NARG1L antibody, Anti-NARG1L antibody, NARGL-1, RP11-396A22.1 antibody, Nmda Receptor Regulated 1-Like antibody, NARGL-1 antibody, NARG1L, NARGL 1, MGC40612 antibody, NARGL 1 antibody |
|---|---|
| Specificity | NARG1L antibody was raised against the middle region of NARG1L |
| Cross Reactivity | Human,Mouse,Rat |
| Applications | WB |
| Immunogen | NARG1L antibody was raised using the middle region of NARG1L corresponding to a region with amino acids RKGKFLLMLQSVKRAFAINSNNPWLHECLIRFSKSVSNHSNLPDIVSKVL |
| Assay Information | NARG1L Blocking Peptide, catalog no. 33R-7993, is also available for use as a blocking control in assays to test for specificity of this NARG1L antibody |
Images
Western Blot analysis using NARG1L antibody (70R-2694)
NARG1L antibody (70R-2694) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 101 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | NARG1L may belong to a complex displaying N-terminal acetyltransferase activity. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product