NARG1L antibody (70R-2694)

Rabbit polyclonal NARG1L antibody raised against the middle region of NARG1L

Synonyms Polyclonal NARG1L antibody, Anti-NARG1L antibody, NARGL-1, RP11-396A22.1 antibody, Nmda Receptor Regulated 1-Like antibody, NARGL-1 antibody, NARG1L, NARGL 1, MGC40612 antibody, NARGL 1 antibody
Specificity NARG1L antibody was raised against the middle region of NARG1L
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NARG1L antibody was raised using the middle region of NARG1L corresponding to a region with amino acids RKGKFLLMLQSVKRAFAINSNNPWLHECLIRFSKSVSNHSNLPDIVSKVL
Assay Information NARG1L Blocking Peptide, catalog no. 33R-7993, is also available for use as a blocking control in assays to test for specificity of this NARG1L antibody

Images

Western Blot analysis using NARG1L antibody (70R-2694)

NARG1L antibody (70R-2694) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 101 kDa (MW of target protein)
Form & Buffer Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NARG1L may belong to a complex displaying N-terminal acetyltransferase activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NARG1L antibody (70R-2694) | NARG1L antibody (70R-2694) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €331.29
Size: 50 ug
OR
Shipping
View Our Distributors