UNC45A antibody (70R-2703)

Rabbit polyclonal UNC45A antibody

Synonyms Polyclonal UNC45A antibody, Anti-UNC45A antibody, GC-UNC45 antibody, SMAP-1 antibody, IRO039700 antibody, UNC45A, UNCA 45, UNCA 45 antibody, Unc-45 Homolog A antibody, UNCA-45, UNCA-45 antibody, FLJ10043 antibody
Cross Reactivity Human
Applications WB
Immunogen UNC45A antibody was raised using a synthetic peptide corresponding to a region with amino acids REIASTLMESEMMEILSVLAKGDHSPVTRAAAACLDKAVEYGLIQPNQDG
Assay Information UNC45A Blocking Peptide, catalog no. 33R-7872, is also available for use as a blocking control in assays to test for specificity of this UNC45A antibody

Images

Western Blot analysis using UNC45A antibody (70R-2703)

UNC45A antibody (70R-2703) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 102 kDa (MW of target protein)
Form & Buffer Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UNC45A plays a role in cell proliferation and myoblast fusion, binds progesterone receptor and HSP90, and acts as a regulator of the progesterone receptor chaperoning pathway.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using UNC45A antibody (70R-2703) | UNC45A antibody (70R-2703) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €331.29
Size: 50 ug
OR
Shipping
View Our Distributors