UNC45A antibody (70R-2703)
Rabbit polyclonal UNC45A antibody
Overview
Overview
| Synonyms | Polyclonal UNC45A antibody, Anti-UNC45A antibody, GC-UNC45 antibody, SMAP-1 antibody, IRO039700 antibody, UNC45A, UNCA 45, UNCA 45 antibody, Unc-45 Homolog A antibody, UNCA-45, UNCA-45 antibody, FLJ10043 antibody |
|---|---|
| Cross Reactivity | Human |
| Applications | WB |
| Immunogen | UNC45A antibody was raised using a synthetic peptide corresponding to a region with amino acids REIASTLMESEMMEILSVLAKGDHSPVTRAAAACLDKAVEYGLIQPNQDG |
| Assay Information | UNC45A Blocking Peptide, catalog no. 33R-7872, is also available for use as a blocking control in assays to test for specificity of this UNC45A antibody |
Images
Western Blot analysis using UNC45A antibody (70R-2703)
UNC45A antibody (70R-2703) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 102 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | UNC45A plays a role in cell proliferation and myoblast fusion, binds progesterone receptor and HSP90, and acts as a regulator of the progesterone receptor chaperoning pathway. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product