CDCA5 antibody (70R-2882)

Rabbit polyclonal CDCA5 antibody raised against the middle region of CDCA5

Synonyms Polyclonal CDCA5 antibody, Anti-CDCA5 antibody, CDCA5, MGC16386 antibody, CDCA-5, CDCA 5 antibody, CDCA-5 antibody, CDCA 5, Cell Division Cycle Associated 5 antibody
Specificity CDCA5 antibody was raised against the middle region of CDCA5
Cross Reactivity Human
Applications WB
Immunogen CDCA5 antibody was raised using the middle region of CDCA5 corresponding to a region with amino acids RRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVP
Assay Information CDCA5 Blocking Peptide, catalog no. 33R-8165, is also available for use as a blocking control in assays to test for specificity of this CDCA5 antibody

Images

Western Blot analysis using CDCA5 antibody (70R-2882)

CDCA5 antibody (70R-2882) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CDCA5 is the regulator of sister chromatid cohesion in mitosis. It may act by regulating the ability of the cohesin complex to mediate sister chromatid cohesion, perhaps by altering the nature of the interaction of cohesin with the chromosomes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CDCA5 antibody (70R-2882) | CDCA5 antibody (70R-2882) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €331.29
Size: 50 ug
OR
Shipping
View Our Distributors