CDCA5 antibody (70R-2882)
Rabbit polyclonal CDCA5 antibody raised against the middle region of CDCA5
Overview
Overview
| Synonyms | Polyclonal CDCA5 antibody, Anti-CDCA5 antibody, CDCA5, MGC16386 antibody, CDCA-5, CDCA 5 antibody, CDCA-5 antibody, CDCA 5, Cell Division Cycle Associated 5 antibody |
|---|---|
| Specificity | CDCA5 antibody was raised against the middle region of CDCA5 |
| Cross Reactivity | Human |
| Applications | WB |
| Immunogen | CDCA5 antibody was raised using the middle region of CDCA5 corresponding to a region with amino acids RRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVP |
| Assay Information | CDCA5 Blocking Peptide, catalog no. 33R-8165, is also available for use as a blocking control in assays to test for specificity of this CDCA5 antibody |
Images
Western Blot analysis using CDCA5 antibody (70R-2882)
CDCA5 antibody (70R-2882) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 28 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | CDCA5 is the regulator of sister chromatid cohesion in mitosis. It may act by regulating the ability of the cohesin complex to mediate sister chromatid cohesion, perhaps by altering the nature of the interaction of cohesin with the chromosomes. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product